Protein Info for MPMX19_04206 in Azospirillum sp. SherDot2

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF08545: ACP_syn_III" amino acids 114 to 190 (77 residues), 68.3 bits, see alignment E=6.6e-23 PF08541: ACP_syn_III_C" amino acids 235 to 322 (88 residues), 85.3 bits, see alignment E=4e-28

Best Hits

Swiss-Prot: 39% identical to FABH_ROSCS: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Roseiflexus castenholzii (strain DSM 13941 / HLO8)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 87% identity to azl:AZL_a06530)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>MPMX19_04206 3-oxoacyl-[acyl-carrier-protein] synthase 3 (Azospirillum sp. SherDot2)
MVASRIDGVCVRGIVGCVPDGRETVADLARRFGEEAARKVAAATGIEERRIVAPGQCTSD
LAEAAARRLLDGLGWEPDSIDLLVLVTQTHDQTLPGTASLLHRRLGLRKGTAVLDITHGC
SGFVYGLWVAGGMLKPAGRRALLLVGDTTSRLIDPEDRAVAPLFGDGAAAVALELDDRAE
PIAFDLGSDGAGAPYLAADGGGMRHPDRPARLFMDGTQVFAFTLREVPGSVRAALDGAGW
TTDMVDHLVLHQANAQMIRHLGQKLGVAADRTVVALREVGNTSSASIPLAVAASLADSLT
AGPRRLLLSGFGVGWSWGSAALVAGPLAVCETVVLPGRKCPAESAAPASPAA