Protein Info for MPMX19_04152 in Azospirillum sp. SherDot2

Annotation: Type I secretion system ATP-binding protein PrsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 18 to 553 (536 residues), 630.1 bits, see alignment E=1.6e-193 PF00664: ABC_membrane" amino acids 20 to 274 (255 residues), 26.3 bits, see alignment E=5.7e-10 PF00005: ABC_tran" amino acids 346 to 493 (148 residues), 111.6 bits, see alignment E=4.8e-36

Best Hits

KEGG orthology group: None (inferred from 95% identity to azl:AZL_a07180)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>MPMX19_04152 Type I secretion system ATP-binding protein PrsD (Azospirillum sp. SherDot2)
MSSVDRPLLTQAYRKIGQGLLLAGVLSLFVNVLMLVLPLFTMQVYDRVMSSRSLETLTML
AIIAVGALALYGVLDFIRARAFLVTSAVIAHRFNVPALEASIVDALSGGPRNAAQTMRDL
NDLRSFMTSSAVTAPLELAWAPIFLAILFLLHPVYGVLAIVSALVLLVMGVLTDMLTRRP
MAQANEASARVFADIAGTVRHAEAIEAMGMLPALARRWQSAQSGSAGMIDRGATLSRGLA
AASRSLRMILQVGVIAAGATLVIDNLVTPGSMMAAGLITGRLLHPFEQLVDGWRQWVKAL
EAHRRIRDLLNNGASARSTMPLPQPQGALTVDRVTHVPSGLNRPVLRNVTFAVQAGEVLG
VIGPSGAGKSTLARLLVGVWQPTAGGIYLDGTSTYLWERESFGKYVGYVPQSVALLDGTI
GENISRMASADPAEIVRAARLAGVHEMIGRLPFGYDTPVGDSAFSLSGGQRQRIALARAL
FGRPRLLVLDEPNSNLDHDGEQALLSAVQKVKADGTTVVMIAHRPSIVAIADKLVVMKDG
AVEHFGARNDVLKLVQPGGAPAGPNTTIARLVRSGEQR