Protein Info for MPMX19_04091 in Azospirillum sp. SherDot2

Annotation: Chemotaxis protein PomA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 154 to 262 (109 residues), 73.3 bits, see alignment E=7.8e-25

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 94% identity to azl:AZL_a02910)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MPMX19_04091 Chemotaxis protein PomA (Azospirillum sp. SherDot2)
MAVSSDTGGARAKAAQGGGTRAAAQGEPAAAGNPTGATAPGRSVRLRGGLDVATLVGLAA
AAGVILIAITTGGSARAFLDPPSLLIVLGGTLAVTTASFSLGDVAVAWKNAAAVLVHQTL
DPKGVARQVLLLAEAARRAGPETLRNVLPELRAEPFLHRSVTLITEGLPPDAIERMLTGE
VEATVGGHGKSAGVLRRASEVAPAMGLIGTLVGLVQMLGSLSDPSAIGPAMALALLTTFY
GAVLGNVVLSPLAAKVERAAEEDALVKTLYTIGAVSIARQENPRRLEMLLNAVLPPGKRI
QYFDREAPRVGA