Protein Info for MPMX19_04090 in Azospirillum sp. SherDot2

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 PF00158: Sigma54_activat" amino acids 121 to 286 (166 residues), 234 bits, see alignment E=2e-73 PF14532: Sigma54_activ_2" amino acids 135 to 291 (157 residues), 77.5 bits, see alignment E=3.1e-25 PF07728: AAA_5" amino acids 144 to 264 (121 residues), 30.2 bits, see alignment E=1.1e-10 PF00004: AAA" amino acids 144 to 279 (136 residues), 25.3 bits, see alignment E=4.7e-09 PF02954: HTH_8" amino acids 460 to 500 (41 residues), 55.8 bits, see alignment 7.3e-19

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_a02900)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>MPMX19_04090 Anaerobic nitric oxide reductase transcription regulator NorR (Azospirillum sp. SherDot2)
MRLLIVGTLEGYITAAGKIAMKRGAKVSHTDSIEGALTALRAAAGADLVMIDVKLDIATF
IDSLKSERITIPVVACGIGTDAAAAVRAIRAGAKEYLPLPPNAELIAAVLEAVAEESHSI
VCSDPAMLATLRLAEQVAPSDASVMITGESGTGKELMARFIHRKSRRSGEPFVAVNCAAI
PENLLESELFGHEKGAFTGAVARRLGKFEEANNGTLLLDELSEMHPRLQAKLLRAIQEKE
IDRIGSSQPVRVNVRLIATSNRNLEAEVRSGNFREDLYFRLNVFSVAIPSLRERPADIPM
IAEHFLKKYAEANGLGDKRLTEDAMLMLKTHHWRGNVRELENTMHRAVLLSRGEEVGPEA
IMLTSKMLAPEGSAQASIPSDSPVANPFAGPGGTVPAAASQPAVPPQGAVPNSSYGATGY
GPPKGGKPGPYGMAANSSAAAAANAGTSGAGLAALIGRTVADVERDLILETLTHCLGNRT
HAANILGISIRTLRNKLKQYGDEGRSVPTPGNDERATA