Protein Info for MPMX19_04058 in Azospirillum sp. SherDot2

Annotation: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 8 to 58 (51 residues), 38.8 bits, E=7.3e-14
• PF01799: Fer2_2
  • amino acids 76 to 164 (89 residues), 95.3 bits, E=1.9e-31

Best Hits

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 81% identity to atu:Atu5498)

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT @ 4-hydroxybenzoyl-CoA reductase, gamma subunit (EC 1.3.99.20)" (EC 1.3.99.20)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.20

Protein Sequence (186 amino acids)

>MPMX19_04058 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (Azospirillum sp. SherDot2)
MGNALMNFTINGQSVEVEADIRSSLLDLLRNSLGFTGTKKGCDQGACGACTVLVDGERIN
SCLALAVQYQGRSITTVEGLGSDGALHPLQQAFVEHDGFQCGYCTPGQLCSAVGMASEIE
RNIPSVVTADLSAGSVAIDETELRERMSGNLCRCGAYNGIIEAISETLVKTPASQTQAKT
QEGARA