Protein Info for MPMX19_04045 in Azospirillum sp. SherDot2

Annotation: Arsenate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details PF12840: HTH_20" amino acids 17 to 68 (52 residues), 47.2 bits, see alignment 2.7e-16 PF01022: HTH_5" amino acids 20 to 66 (47 residues), 30.4 bits, see alignment 4.3e-11 PF01451: LMWPc" amino acids 145 to 278 (134 residues), 50.1 bits, see alignment E=5.1e-17

Best Hits

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>MPMX19_04045 Arsenate reductase (Azospirillum sp. SherDot2)
MGSLMEKKDVLTGLAALAQETRLDIFRLLVEAGPEGRAAGSIAEALAVAPATLSFHLSAL
TNAGLILQRRESRSLIYSADFERMSGILGFLSENCCGRSANAGACIPVCAPTPEAANGEK
TAAPRCGCRDPKTERKMAENRVYNVLFLCTHNSARSVMAECLLNREGKGRFRGFSAGSQP
SGRINPYVRDLLERLGFPTADLRSKTWDEFAAPGAPHMDFIVTVCDNAAGEVCPVWPGQP
IGAHWGFPDPSGAEGSDAEKAAFTATVFGQIERRIRSFASMPIASLDRMALKRRMDDMAR
AKP