Protein Info for MPMX19_04033 in Azospirillum sp. SherDot2

Annotation: Colistin resistance protein EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 86 to 133 (48 residues), 54.3 bits, see alignment 1.3e-18 PF16576: HlyD_D23" amino acids 236 to 327 (92 residues), 45.9 bits, see alignment E=6.3e-16 PF13437: HlyD_3" amino acids 253 to 331 (79 residues), 42.4 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 37% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 62% identity to mno:Mnod_0312)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>MPMX19_04033 Colistin resistance protein EmrA (Azospirillum sp. SherDot2)
MPDDQQRRDVVDLTGQEADSQAGRSERGQPAAGEDRKTPGFIRRHPIAILALLVVIALLA
VAGYIYWQRNIHPYESTDDAFIDTRQFPVAAKVGGYVTEVAVGDNRHVNAGDLLFRIDTR
DYQTALDQAQAQIDSAQAAITGYDAQIDAQRAQIEQARAEVSQAEAAVGFAKEDAARYRD
LQSRGAGTVQQAQQSTATLQEQQGKLTSANAAVIAAERQVGALQAQRTSAVADLARAKAQ
LAQAQLNLSYTAVAAAQPGRVVQLSGAVGQFAQAGQSLAIFVPDDIWVTANFKETQITDM
RPGQPVDIHIDAYPGRKVTGHVDSVQPGSGTAFSLLPAENATGNYVKVVQRIPVKIVVDQ
WPDGVSIGPGMSVVPRVTVR