Protein Info for MPMX19_03969 in Azospirillum sp. SherDot2

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF00578: AhpC-TSA" amino acids 28 to 141 (114 residues), 47.7 bits, see alignment E=1.5e-16 PF08534: Redoxin" amino acids 29 to 151 (123 residues), 102.3 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 63% identical to PRX5_RHIET: Peroxiredoxin from Rhizobium etli

KEGG orthology group: None (inferred from 93% identity to azl:AZL_a02670)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>MPMX19_03969 Peroxiredoxin (Azospirillum sp. SherDot2)
MEGRKVPSVVFKTRVRDESVGGPNPFRWQDVQSDELFKGKRVVVFSLPGAFTPTCSNEQC
PAFERLHDDFKALGIDEVYCISVNDAFVMYQWGKSLNLQKVKLIPDGSGHFTRRMGMLID
KDSLGFGFRSWRYAMVVKDGVVEKWFEEPGINDEGENGDPYGESSPENVLAFLRS