Protein Info for MPMX19_03967 in Azospirillum sp. SherDot2

Annotation: Type I secretion system membrane fusion protein PrsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 49 to 71 (23 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 53 to 468 (416 residues), 291.1 bits, see alignment E=7.4e-91 PF00529: CusB_dom_1" amino acids 62 to 426 (365 residues), 35.7 bits, see alignment E=1.6e-12 PF13533: Biotin_lipoyl_2" amino acids 99 to 137 (39 residues), 33.6 bits, see alignment 6.7e-12 PF13437: HlyD_3" amino acids 322 to 426 (105 residues), 41.4 bits, see alignment E=5.4e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to azl:AZL_a02650)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>MPMX19_03967 Type I secretion system membrane fusion protein PrsE (Azospirillum sp. SherDot2)
MTTMTTTFPAPLSSDNGPETPAGKPSRKTATITSIHALRAAMPETNARGLLLGGFLVLAV
GFGGMTGWAAVAPLHSAISASGSLAPETGRKVVKNTEGGVISAIMVNEGDRVEAGQVLMR
LDSTEAQTRLEMLNAALFDTLASEARLSAELFEKPAIEWPDALAARRAREPAVENAMVNQ
EKLFQVRRTQLDTEAKLTKDRIATLGDEVQSLEKQRAFLAREIKLSDEDIQITQGLLDRG
NSTRTKLVAAQKENAQLHAQDHELEARMSQSRQQAVDAQGDLVRRRSDFREKVLVELDKA
RGDAQKLAEQIRDAKNRLDNRTVKAPDAGNVVMYGHPAVGGSITANEPVLDIVPDDKALL
AEVRIQPKDIKSMAVDLPVKVQLTAYDSRVVGTIDGTVSYVSADRLTDNATRQEYYLARI
RLKDADSHEVRHMKIKAGMPVEARIVLSARTPLDYLIQPLRQSYVKAFIQE