Protein Info for MPMX19_03905 in Azospirillum sp. SherDot2

Annotation: Sialic acid TRAP transporter permease protein SiaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 205 to 237 (33 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 280 to 282 (3 residues), see Phobius details amino acids 284 to 313 (30 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details amino acids 471 to 493 (23 residues), see Phobius details amino acids 516 to 547 (32 residues), see Phobius details amino acids 560 to 586 (27 residues), see Phobius details amino acids 599 to 620 (22 residues), see Phobius details PF04290: DctQ" amino acids 44 to 169 (126 residues), 93.6 bits, see alignment E=9.4e-31 PF06808: DctM" amino acids 211 to 619 (409 residues), 346.2 bits, see alignment E=2.6e-107 TIGR00786: TRAP transporter, DctM subunit" amino acids 220 to 621 (402 residues), 281.2 bits, see alignment E=6.1e-88

Best Hits

KEGG orthology group: None (inferred from 77% identity to bra:BRADO3834)

Predicted SEED Role

"Predicted gluconate TRAP family transporter, DctM subunit" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>MPMX19_03905 Sialic acid TRAP transporter permease protein SiaT (Azospirillum sp. SherDot2)
MTAVVDHKSTAGPSDSASPWLAQVDRLLGWLSELPVALLVAAEVVILFTGIVARYVLHAP
ITWSDELASILFLWLAMLGVVVAFRRGEHMRMTAFVSWASPRARAFLDVFAVAAALCFLL
LVILPAGEFAWEELEITTPALQISNMWRAAALPTGLGLMIATALVRLARVGDVRLVAGAL
AAVAAIAALFTVLQPVLADLGKLNLLVFFVVVVAGSVFAGVPIAFAFGLSSFGYLALTTK
VPLLVVVGRMDEGMSHLILLSVPLFVFLGLLIEMTGMARAMVAVLANLLGHVRGGLSYVL
IGAMYLVSGISGSKAADMAAVAPVLFPEMKNRGAKPGDLVALLAATGAQTETIPPSIVLI
TIGSVTGVSIAALFTGGLLPGLLLAVMLCLVVRHRYRNEDLSGVRRPTGGELGKSLVVAL
PALALPFVIRTAVIEGVATATEVSTIGIVYAVAVGLLVYRRFDWRRVVPMLVETAALSGA
ILFIIGTATGMAWCLTRSGFSTDLAHFMASLPGGSFTFLAVSIVAFIVLGSVLEGIPAIV
LFGPLLFPIAREMGVHEVQYAMVVILAMGLGLFAPPFGVGFYVASAIGRVNPDEGMRPIM
GYLAALLAGLALVAAIPWISTGFL