Protein Info for MPMX19_03896 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 469 to 486 (18 residues), see Phobius details amino acids 500 to 521 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 26 to 387 (362 residues), 223.6 bits, see alignment E=2.5e-70

Best Hits

KEGG orthology group: None (inferred from 72% identity to oca:OCAR_4724)

Predicted SEED Role

"FIG138928: iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>MPMX19_03896 hypothetical protein (Azospirillum sp. SherDot2)
MKTDNVKREREQRPAGRGIRQSMSGLHIWAGLLMGWILYAMFLTGTVSYFKDELSQWMRP
ELAHQAVLPDPALVAQRVADELATIAPGSPQWSMRLPDARTNSVYAFWRMAPGEAGAAPG
RRAFGEAAFDPATGGKVTARETLGGDFFYRFHFQFHYMPVLWGRWIAGAAAMFMLVAIVS
GVITHKKIFIDFFTFRGGKGQRSWLDAHNALSVFGLPFHAMITYTGLVTLMALYMPWGER
TAIATQAERQQLTAELNAFIQPGKPSGQAAPLASVADMVGQAQERWGQDAVGRVTATNSG
DSTARVAVARGEAGRVSMSPQYMLFDGPTGRLLETREGVGAAAETRGVLYALHLGRFSDV
VTRWLYFLVSLMGTAMVGTGLVMWTVKRRQKLADSERPHIGFRIVERLNIASIAGLSVAM
TAFLWGNRLLPAGLADRGAWEIHLFFAVWALTLAHAVLRPARTAWIEQLWAAAALLALLP
VLNAVTTDRPLWHSVAEADWVFAGMDLMCLSLAALHAVLALRTARHRPKPRAVPAKGRGG
VIGGALEEGRS