Protein Info for MPMX19_03890 in Azospirillum sp. SherDot2

Annotation: Riboflavin transport system permease protein RibX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 61 to 84 (24 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 72 to 245 (174 residues), 100.1 bits, see alignment E=6.6e-33

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 80% identity to met:M446_3606)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MPMX19_03890 Riboflavin transport system permease protein RibX (Azospirillum sp. SherDot2)
MSYDLRRRLWAALLILGFFAAWEILCLVLQVSDLVLPRPTQVFATLAARFGILWPHVMQT
LWTTMIGFVLGVTVGVVIGAAIGVSRTAYDTVYPLLIGFSSIPKVAVVPIFVLWFGSGAT
PAILTALAMCFFPIVVNIATGLATTEPELEDVLKSLGASRFDILWNVGLPRTMPFFFASL
KIAVTFAFVGSVLSETVASNKGIGNVMMTASSNFDVPLVFAGLFLLAALGILLYVAFSLV
EARVTGWATRRQGFASA