Protein Info for MPMX19_03868 in Azospirillum sp. SherDot2

Annotation: Xylitol-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 28 to 266 (239 residues), 83.5 bits, see alignment E=2.7e-27 PF13407: Peripla_BP_4" amino acids 30 to 286 (257 residues), 180.7 bits, see alignment E=6e-57 PF13377: Peripla_BP_3" amino acids 153 to 299 (147 residues), 29.3 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 34% identity to tpt:Tpet_1794)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX19_03868 Xylitol-binding protein (Azospirillum sp. SherDot2)
MTRSPIRFAGSLAALLLLSTAPALAQDKAIGFAIPNLASSFWISAVYGAEQEAKAAGVTL
VKLNAGGDANSSQQIAQIQDLAQRGVAAIIVGATNGDAVRAVVEQAVGRGIPVIGISSPP
NSDRLSATVSADHYDMGRLQARCLAQAIGGKGEVAMMAGPTGQAWSDLRAKGFRETLAKE
APGVTVVAESRLADNRNAALTTAEDWTQRFPELKGVYAATDDMAAGVVAAMKAAGRMPAV
RVSASNFSPTAQQLLKDRELACTSIQQVVAQGRAAFTQALAAAGKKPVEAKVVLPALLVT
SDTLGEVDLSSVVAPADYRP