Protein Info for MPMX19_03867 in Azospirillum sp. SherDot2

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 259 to 289 (31 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 313 (263 residues), 111.5 bits, see alignment E=2.1e-36

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 42% identity to sro:Sros_1400)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>MPMX19_03867 Ribose import permease protein RbsC (Azospirillum sp. SherDot2)
MSARLLRRSADGLRAAGSVLPIPFRVAPLCLILAVAVFAATAPRFLSLGNAANIGAQVWV
LALLAIGQMFVLATRGFDISVGAVAALSSVCAAMACNAWGLPGLAAGALAGLFCGLVNGA
LVGTLGLQPVVATLGSLIAVRGLSLLITGDGQVVPLDAAGAVTRLGFEPMPVLPAASWAA
LVLAVGAALLVGRSLAGRRILMAGSNPEAVALVGVDTRRVQLWAYGLCGLFAGLAGVLMT
VRAGSGLPTEGAGMELQAIAAAVIGGTALSGGIASVAAVVIGAAFIQVLLTGLNLQGVSP
FVAQIAVGVVIIASGLLETLLRSLPSFHSQSRTRT