Protein Info for MPMX19_03822 in Azospirillum sp. SherDot2

Annotation: Sulfur carrier protein FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 46 to 271 (226 residues), 173.5 bits, E=2.4e-55
• PF02634: FdhD-NarQ
  • amino acids 49 to 278 (230 residues), 220.8 bits, E=1.2e-69

Best Hits

Swiss-Prot: 49% identical to FDHD_XANC5: Sulfur carrier protein FdhD (fdhD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02379, FdhD protein (inferred from 90% identity to azl:AZL_a00180)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• superpathway of C1 compounds oxidation to CO₂ (9/12 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• oxalate degradation VI (2/4 steps found)
• oxalate degradation III (2/5 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (280 amino acids)

>MPMX19_03822 Sulfur carrier protein FdhD (Azospirillum sp. SherDot2)
MTAMPSGSIPPDDSSPLSTAMCSIAVTGTGFSAGVGMEEGADVEWQVPEETAVAFEYNGR
SHAVMMATPADLEDFALGFSLAEEIVGTAADIENIAVRETPLGFVVNLTVDPLRLLRGSL
RSRSMEGRSGCGLCGVDSLVHAVREPRKIETSLEVDPAAVAAAFRALPDHQPMNRANRSV
HAAAWCAPDGAVRMAREDVGRHNALDKLIGAVVRSGADPATGFVVMTSRCSFELVQKTAA
VGIPLLATISAPTALALELARNANLTLGALSRRDTVILFR