Protein Info for MPMX19_03759 in Azospirillum sp. SherDot2

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 305 (270 residues), 149.8 bits, see alignment E=4.3e-48

Best Hits

Swiss-Prot: 63% identical to RBSC_HAEIN: Ribose import permease protein RbsC (rbsC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 96% identity to azl:AZL_b03520)

MetaCyc: 58% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>MPMX19_03759 Ribose import permease protein RbsC (Azospirillum sp. SherDot2)
MTTLKRFLSRNKPLVGLIVLMAAVAVMSPSFMTVDNLLNILRQTSINAVIAVGMTYVILS
GGIDLSVGSVLAFCGAVCAWLVAGDLSIWLAIPLSLLLGAGLGAINGVVIGTGGVQPFVA
TLVAMTMLRGATLVFTDGRPITTGTGAAADAFWSVGGGYLLGIPVPVVVAAAVFAVCGLV
LTRTRFGRYTYAVGGNEVVARLSGIRVNLEKTTIYALSGLLAALAGVILTARLESAQPTA
GAGYELDAIAAVVVGGTSLSGGKGTLFGTLVGALIIGVLNNALNLMDVSSYYQMIAKGAV
ILLAVLADSRKSP