Protein Info for MPMX19_03706 in Azospirillum sp. SherDot2

Annotation: Arginine transport system permease protein ArtQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 108 (41 residues), see Phobius details amino acids 149 to 152 (4 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 112 (99 residues), 103 bits, see alignment E=5.3e-34 PF00528: BPD_transp_1" amino acids 35 to 217 (183 residues), 71.7 bits, see alignment E=3.5e-24

Best Hits

Swiss-Prot: 35% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 60% identity to vap:Vapar_5241)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>MPMX19_03706 Arginine transport system permease protein ArtQ (Azospirillum sp. SherDot2)
MDYAFDFALVVETFPILMRGFVVTLELWLPSLAIGLAAGLVLALARLSRSRLLRGGSLVY
IELFRDTPVLIQLIWFYYAFPILIGLQLSPFTAALLALALNTSAYGAEIFRGGIQSIARG
QWEGAKALGMRHADVLRRIILPQVFKLMLPAFTNRAVEVAKMSSLASVLSVHELMYQGRL
LSSTYYRPFEILTTVAVVYFVLIYPATFLSMTLERRMAGKG