Protein Info for MPMX19_03678 in Azospirillum sp. SherDot2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 192 to 209 (18 residues), see Phobius details PF08269: dCache_2" amino acids 29 to 191 (163 residues), 126.5 bits, see alignment E=3.1e-40 PF17200: sCache_2" amino acids 36 to 184 (149 residues), 152.6 bits, see alignment E=2e-48 PF17201: Cache_3-Cache_2" amino acids 68 to 181 (114 residues), 39.7 bits, see alignment E=9.4e-14 PF00672: HAMP" amino acids 206 to 258 (53 residues), 39.2 bits, see alignment 1.8e-13 PF00015: MCPsignal" amino acids 358 to 532 (175 residues), 93.6 bits, see alignment E=3.2e-30

Best Hits

KEGG orthology group: None (inferred from 93% identity to azl:AZL_b04630)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>MPMX19_03678 Methyl-accepting chemotaxis protein (Azospirillum sp. SherDot2)
MKLKIGTRLMLLVFGVALLSTLAGATVHLTGTRTNLIEQRKAKVKEMVDAAASVIALYGE
QEKSGKLPRAEAQERARDAVRAMRYGNGEYFFVYDYAGVSLVHGLRPQVEGKNLLNLKDP
DGVPFNVQMTEAAKAGGGFVAFRHKRSDDAEPTPKIAYAAGYQPWQWMIGTGVYTDDVDA
EFRARIWRELEVSLLLLAISVGIGIWVSRGMSRPLLAIRDVLGRIGGGDLTAAVPHADRP
DEIGDMARAVAGLATTLQGARDESQRADLERAARDLQRERLSVRAAEFARAMDEVVATLS
TTTVALHERTAALTNDAASTTDEAHAAAGAAQGASDSVESAAQASEELRGSIAAISRQVE
SAAQTASRAVTETSNTTGIVTGLASAAEQIGAVVELINSIAGQTNLLALNATIEAARAGE
AGKGFAVVASEVKSLATQTAKATEDIQSQVGAIRAATANAIGAIESIASLITNLSALNGE
VASAVQQQEAATHQIFANARAAADNSRRVTSSVGSLSSTMTTTSERMRLVSTSVESVSGQ
SERLKDEVRRFVAEVNAA