Protein Info for MPMX19_03667 in Azospirillum sp. SherDot2

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 2 to 192 (191 residues), 177 bits, E=6.3e-56
• PF01370: Epimerase
  • amino acids 4 to 89 (86 residues), 28.3 bits, E=2.4e-10
• PF08659: KR
  • amino acids 5 to 161 (157 residues), 82.3 bits, E=8.4e-27
• PF13561: adh_short_C2
  • amino acids 13 to 238 (226 residues), 180.8 bits, E=6.8e-57

Best Hits

Swiss-Prot: 45% identical to FABG_STAAM: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 75% identity to dar:Daro_4188)

MetaCyc: 35% identical to L-xylo-3-hexulose reductase (Aspergillus niger ATCC 1015)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• D-galactose degradation IV (1/3 steps found)
• biotin biosynthesis I (9/15 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Protein Sequence (239 amino acids)

>MPMX19_03667 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Azospirillum sp. SherDot2)
MKRALVTGGSGALGAAICKALAADGNHVLVHANGSIARAEALTAEIAASGGSAQAVAFDV
TDVDATGEALEQVLESGPIQILVNNAGIHDDAVMPAMRREQWGRVIDVSLNGFFNVTQPL
LMPMIGTRWGRIVTVSSVAAIAGNRGQTNYAAAKAGLHGATKSLALELAPRGITVNAVAP
GIIASPMADAAFDADMVKRMVPMKRAGRPEEVADLVAFLASDRAAYISGQIVSINGGMI