Protein Info for MPMX19_03652 in Azospirillum sp. SherDot2

Annotation: Sorbitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00106: adh_short" amino acids 11 to 194 (184 residues), 176.2 bits, see alignment E=8.4e-56 PF08659: KR" amino acids 14 to 168 (155 residues), 27.8 bits, see alignment E=3.5e-10 PF13561: adh_short_C2" amino acids 17 to 257 (241 residues), 183.2 bits, see alignment E=9.6e-58

Best Hits

Swiss-Prot: 82% identical to SDH_RHOSH: Sorbitol dehydrogenase (polS) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 96% identity to azl:AZL_b04800)

MetaCyc: 66% identical to galactitol 2-dehydrogenase (Agrobacterium fabrum C58)
Galactitol 2-dehydrogenase. [EC: 1.1.1.16]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MPMX19_03652 Sorbitol dehydrogenase (Azospirillum sp. SherDot2)
MTSPMKRLDGKSAIVTGAARGIGRAFAAAYVAEGATVAIADINLAAAEKAAAEIGPGAYA
VALDVTSQSSIDAAVAAVVERAGGIDILINNAALFDLAPIVEITRDSYDRLFSINVAGTL
FTLQAVAKRMIAQGRGGKIVNMASQAGRRGEALVGVYCATKAAVISLTQSAGLDLIKHGI
NVNAIAPGVVDGEHWDGVDALFAKHEDLQPGEKKRMVGEAVPFGRMGRAEDLTGMAIFLA
SREADYIVAQTYNVDGGNWMS