Protein Info for MPMX19_03634 in Azospirillum sp. SherDot2

Annotation: Arginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00491: Arginase" amino acids 10 to 304 (295 residues), 237.3 bits, see alignment E=1.2e-74 TIGR01229: arginase" amino acids 13 to 308 (296 residues), 325.8 bits, see alignment E=1.4e-101

Best Hits

Swiss-Prot: 68% identical to ARGI_BRUME: Arginase (arcB) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 92% identity to azl:AZL_b04890)

MetaCyc: 59% identical to arginase subunit (Agrobacterium tumefaciens)
Arginase. [EC: 3.5.3.1]

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX19_03634 Arginase (Azospirillum sp. SherDot2)
MSYHKTKTKQCRLVGVPVQDGAGRLGCEMGPSAYRTAGIAKALSDLGHSVTDLGNVAPLP
QRPPAHGNAALKFLPEVAGWTAALTQVAYEASAGQDAMPIFLGGDHSLAAGTLTGLAQRA
AEMRRPLFVLWLDAHPDFHTLETTESGNLHGVPMAYATGLAGFDGYFPAPPARLDPHNVC
MMGIRSVDPAERRALENSDITVHDMRKIDEHGIVALLRPFLERVVEADGLLHVSLDVDFL
DPGIAPGVGTTVPGGATFREAHLIMEMLHDTGLVSSVDLVELNPFLDERGRTATLMVELL
ASLMGRRVLDYPTRSF