Protein Info for MPMX19_03608 in Azospirillum sp. SherDot2

Annotation: N-acetylmuramic acid 6-phosphate etherase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 45 to 164 (120 residues), 29.8 bits, E=2.8e-11

Best Hits

Swiss-Prot: 46% identical to MURQ_DEIRA: N-acetylmuramic acid 6-phosphate etherase (murQ) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K07106, N-acetylmuramic acid 6-phosphate etherase [EC: 4.2.-.-] (inferred from 91% identity to azl:AZL_b05050)

Predicted SEED Role

"N-acetylmuramic acid 6-phosphate etherase"

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.-.-

Use Curated BLAST to search for 4.2.-.-

Protein Sequence (302 amino acids)

>MPMX19_03608 N-acetylmuramic acid 6-phosphate etherase (Azospirillum sp. SherDot2)
MAGGTEDAANRYSRLDVWPAAELMTALWEGQTRALAACAPALPLVAAAVEAAADRLAAGR
GRLVYAGAGSSAMVAALDGLDLGPTFDWPAERLVLLIAGGLDLSRGLAGAAEDDEGAGRA
DAARAGVCADDVVVGLSASGASAYTVGVLRAAREAGALTMGIASSAGSPLLDAVEHPVLT
ATGAEVIAGSTRLGAGTAQKVVLNLFSTGVMTALGNVYDNLMINVRPENAKLRRRCTAMV
ARIAGVDEDAAGAALERHGDVRRAVLGLAGLEAPEIDRLLTGTGGNLRRAMEQAWSGANT
QE