Protein Info for MPMX19_03602 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 271 (186 residues), 48.7 bits, see alignment E=3.8e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 96% identity to azl:AZL_b05110)

Predicted SEED Role

"Putrescine transport system permease protein potI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>MPMX19_03602 hypothetical protein (Azospirillum sp. SherDot2)
MNTSRRGLSFYLLGAFFALFVLFLYGPTATILILSFQGPEGGLTFPMNGVSLHWFRNLFE
QQAVGDFGGSFRRSIALGLMVMVLTVLFSVLAGFAFRRRFRGSGAIFYLAVASLIVPSIL
VSLGIGLFFNILGLEPSWYSSALGAHLTWTLPFGLLIVFAIFNRFNPAYEEAARDLGATP
WQTVRHVVLPILLPSLIGVGLFGFTLSYDEFARTLMTAGSFNTLPLEIYGMTTNVTTPVL
YALGSLTTVFSFTVIGLFFLGLIALRRRRLRHSGH