Protein Info for MPMX19_03549 in Azospirillum sp. SherDot2

Annotation: HTH-type transcriptional regulator PgrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00126: HTH_1" amino acids 5 to 64 (60 residues), 78.9 bits, see alignment E=2.2e-26 PF03466: LysR_substrate" amino acids 89 to 295 (207 residues), 124.4 bits, see alignment E=4.3e-40

Best Hits

Swiss-Prot: 41% identical to OPRR_PSEAE: Putative transcriptional regulator (PA2220) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 72% identity to smk:Sinme_6613)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>MPMX19_03549 HTH-type transcriptional regulator PgrR (Azospirillum sp. SherDot2)
MQIDLNLLTLFAAVAETGNFRAAADRLGVTRSAVSQGVQRLEAALGQALFLRTTRSVRLT
EAGERFLAQVSTPLAEIAGAIDAASGSAAEPRGLLRIAVTSIAERFLSGPLIASFSEAYP
GVTLDVTVTDLEFDIVAAGFDAGVRLGEVIERDMIAVPLTGDQRQIAVATPGYLARHGTP
GHPRDLVRHRCIGWRPQPETAPYRWEFEKDGHAFDVSVEPQITTNDMLLMLRTALAGAGI
TFGIEETFQPYLERGELVTILDDWLPPFAGFFLYFPSRRTVTPKLRALIDHVRRHREGTK
SG