Protein Info for MPMX19_03547 in Azospirillum sp. SherDot2

Annotation: putative oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00106: adh_short" amino acids 5 to 195 (191 residues), 188.2 bits, see alignment E=2.4e-59 PF08659: KR" amino acids 7 to 169 (163 residues), 58.7 bits, see alignment E=1.5e-19 PF13561: adh_short_C2" amino acids 11 to 220 (210 residues), 142 bits, see alignment E=4.8e-45

Best Hits

Swiss-Prot: 49% identical to Y1627_STAS1: Uncharacterized oxidoreductase SSP1627 (SSP1627) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 65% identity to sno:Snov_2036)

MetaCyc: 42% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>MPMX19_03547 putative oxidoreductase (Azospirillum sp. SherDot2)
MTIDQVVLITGASSGIGEATARILAGAGTTLMLGARRTERLDALVREIQAKGGRAAARAL
DVTDRASMEGFVAEARDRFGRIDVLVNNAGVMPLSPLASLKVEEWDRMIDVNIRGVLHGI
AAVLPVMEAQGGGYVVNIGSVGSFEVVPTSAVYSATKFAVRAITDGLRQESETIRTTCIY
PGVTRSELADTITDETAARAMVEYRRNAIEPEAIGRAVLFAIEQPRDVGVNEITVRPVAR
S