Protein Info for MPMX19_03543 in Azospirillum sp. SherDot2

Annotation: putative ABC transporter ATP-binding protein YejF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 101.2 bits, see alignment E=3.2e-32 amino acids 301 to 452 (152 residues), 101.4 bits, see alignment E=2.8e-32 PF08352: oligo_HPY" amino acids 234 to 265 (32 residues), 16.8 bits, see alignment (E = 2.9e-06)

Best Hits

KEGG orthology group: None (inferred from 74% identity to bbt:BBta_3716)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>MPMX19_03543 putative ABC transporter ATP-binding protein YejF (Azospirillum sp. SherDot2)
MTAVLSLRDYTLDYLTGSRPLRVLQDISLDIAPGEVLGLVGESGSGKSTLAWAIMRHLPK
NARELSGSIRLGDTDLRSLPPRELTRIRGRRIGMVFQDPSTALNPTLTVGRQVTETLVTN
RGLTRRAAWDLALELLGHVELRDPEALMRRYPHEISGGEKQRILIATAFGCRPELIVFDE
PTTALDVITGARILDLFARLRAETGVAALYISHDLALVSRVADRVAVMKKGRLVEEAPAA
SIFARPAHEETRKLVAAVPRPENRLVHDRPGDRVLLAAEAVSVRYARPRLFRPPPPPATH
AVGFDIRAGEILGIVGESGSGKSSIARALTGLAEFSGGIRFDGRPIGSARDMDGAYRRAV
QIVFQHPDGSLNPRQTVGEILSRPLKLFGTGSGNPTTGNLSAEIGRLLEQVRLPAAYATR
WPHQLSGGEKQRVAIARAFAAKPSLVICDEITAPLDVSVQASIIELLLALRAETGAAYLF
ITHDINLIRQIAHRIAVMRRGELVDLLPIDAVDADHVHPYTRDLMAASPTPVG