Protein Info for MPMX19_03535 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 78 (40 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 251 to 276 (26 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 298 (264 residues), 116.4 bits, see alignment E=6.9e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 96% identity to azl:AZL_a06770)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>MPMX19_03535 hypothetical protein (Azospirillum sp. SherDot2)
MTAPFHKTLRNHALALATLLALAAAPFLGFGDGFALSLLARAMILGMAAVSLSLLVGGAG
LVSLGHAATMGIGAYAVVAFDDAGVSEGLIVFPAAIAAAAAYALVTGAVSLRTSGVHFIM
ITLAFGQMAFFTTSSFSSLGGDDGYTLYARTEWLGSRILDNRLTFHFLCLGLLALVWVGG
TLLLGSRFGRVLRAARENPQRALAVGFQPYPYRLVAYAMAGAVGGLSGALLANATEFVSP
ALLSWTRSGELLFMVILGGVGQLGGAILGALAIVLLEETLSHLLVYWRLVFGPLLVLSVL
FLPDGLIGAPLRLRAAFRFASPKRRNADA