Protein Info for MPMX19_03514 in Azospirillum sp. SherDot2

Annotation: Formate hydrogenlyase subunit 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 66 to 88 (23 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF00146: NADHdh" amino acids 14 to 307 (294 residues), 179.6 bits, see alignment E=4.9e-57

Best Hits

Swiss-Prot: 52% identical to HYFC_ECOLI: Hydrogenase-4 component C (hyfC) from Escherichia coli (strain K12)

KEGG orthology group: K12138, hydrogenase-4 component C [EC: 1.-.-.-] (inferred from 95% identity to azl:AZL_b04410)

Predicted SEED Role

"Hydrogenase-4 component C"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MPMX19_03514 Formate hydrogenlyase subunit 4 (Azospirillum sp. SherDot2)
MLTFSHLILGLFQALLLFAAAPLVSGLSRMVRAKLHTRHGPGLLQDYRDIAKLLTRQDLT
PPDSGFAFRAMPAVMLTTVLVIAMGIPMLTRFTPVAPIGDLITVIYLFALARFFFSLSGI
DSGSSFSGIGGSRELTMGVLVEPVMLLSLFVAALLAGSTNLGAIGSAIADGHVRSATATV
IAALSFAYAIYIELGKLPYDMAEAEQELQEGPLTEYSGPSLALIKWAMALKQTVVVAWFI
GVFLPFGSATGMTVFGLLFGLVAFAIKLVLIFAAVGVVENSVARVRFRLTPQHSWVGVGA
ASLAFVFYLVGL