Protein Info for MPMX19_03509 in Azospirillum sp. SherDot2
Annotation: NAD(P)H-quinone oxidoreductase subunit I, chloroplastic
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to HYFH_ECOLI: Hydrogenase-4 component H (hyfH) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 91% identity to azl:AZL_b04360)MetaCyc: 48% identical to hydrogenase 3 iron-sulfur protein HycF (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]
Predicted SEED Role
"Formate hydrogenlyase complex 3 iron-sulfur protein; Formate hydrogenlyase subunit 6; Ni,Fe-hydrogenase III medium subunit"
MetaCyc Pathways
- superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
- hydrogen production III (1/1 steps found)
- hydrogen production VIII (1/1 steps found)
- hydrogen production VI (1/2 steps found)
- superpathway of hydrogen production (1/2 steps found)
- superpathway of photosynthetic hydrogen production (3/6 steps found)
- L-glutamate degradation VII (to butanoate) (5/12 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.12.7.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (191 amino acids)
>MPMX19_03509 NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Azospirillum sp. SherDot2) MLKLLKEIFRTGEATVKYPFAPMPVCKDFRGKPDHNAVDCIACAACTVACPANAIGMETD TAAGSRTWSIDYGRCVFCGRCEESCPTGAIRLSDDFELAVGSKADLTRKAVFTLADCACC GKPFAPAKEVDYVARLLSQSARSAEEADRLRLIASTCPACKRAQDVHHIAGMGIARQMET GKPVKELETTP