Protein Info for MPMX19_03504 in Azospirillum sp. SherDot2

Annotation: Sulfur carrier protein FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 15 to 256 (242 residues), 190.7 bits, E=1.4e-60
• PF02634: FdhD-NarQ
  • amino acids 19 to 256 (238 residues), 234.8 bits, E=6.1e-74

Best Hits

Swiss-Prot: 52% identical to FDHD_XANAC: Sulfur carrier protein FdhD (fdhD) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02379, FdhD protein (inferred from 52% identity to xac:XAC2487)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• superpathway of C1 compounds oxidation to CO₂ (9/12 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• oxalate degradation VI (2/4 steps found)
• oxalate degradation III (2/5 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Protein Sequence (260 amino acids)

>MPMX19_03504 Sulfur carrier protein FdhD (Azospirillum sp. SherDot2)
MQAIVRTDSGFDRREEKIVDEMPVGLVYADDLFAVMLATPTDLEDFATGFSLSEGIVGSA
DELAVTAIDELTDGVRIRMQLPVERLAALLRRKRNLMGGSGCGRCGTDSFAETLRPLDPV
RSAACIEPDAIIRAMAALPAGQSLNRETGAVHAAGFARPDGGLVAVREDVGRHNALDKLI
GALARARIDPTGGFVVVSSRCSFEMVHKTAAADIPLIAAISAPTSLCVGFAETVGVGVVA
FVRQGRLTVYAVPSRVAMPA