Protein Info for MPMX19_03503 in Azospirillum sp. SherDot2

Annotation: Hydrogenase maturation factor HybF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 112 (112 residues), 107.5 bits, E=2.1e-35
• PF01155: HypA
  • amino acids 1 to 112 (112 residues), 109.7 bits, E=4.2e-36

Best Hits

Swiss-Prot: 53% identical to HYPA_BEII9: Hydrogenase maturation factor HypA (hypA) from Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 85% identity to azl:AZL_b04300)

MetaCyc: 34% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (6/10 steps found)

Protein Sequence (113 amino acids)

>MPMX19_03503 Hydrogenase maturation factor HybF (Azospirillum sp. SherDot2)
MHELSLCERLIDLLQEESQRHAFHRVTRIRLAVGRFACVDPEALRFAFDVVRRDTLAEGA
TVDIQQPPGLVWCEDCSSEREVQTRLSPCPVCGGLRLSPRGGDDLTLVELEVA