Protein Info for MPMX19_03489 in Azospirillum sp. SherDot2

Annotation: Spermidine/putrescine import ATP-binding protein PotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00005: ABC_tran" amino acids 25 to 163 (139 residues), 123.8 bits, see alignment E=8.4e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 36 to 360 (325 residues), 362.6 bits, see alignment E=8.6e-113 PF08402: TOBE_2" amino acids 282 to 361 (80 residues), 35.1 bits, see alignment E=1.1e-12

Best Hits

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 72% identity to smd:Smed_5470)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>MPMX19_03489 Spermidine/putrescine import ATP-binding protein PotA (Azospirillum sp. SherDot2)
MSSSSLSVQGLAKRYGDFVALAPTDLVVADGEFLTLLGPSGSGKTTLLSLLAGLVPPDEG
SVRIGSQDVTYAPPYERDIGVVFQNYALFPHMTIEENIAFPLKMRKVGATEAKRRALEAL
EMVHLPHIAGRYPRELSGGQQQRVALARCMVYKPSIILMDEPLGALDKKLREHMQLEIKR
LHRELGTTVVYVTHDQEEAMTMSDRICLMNAGRIEQLGTPADLYFRPRSLFVADFLGESN
ILPAALGSRSGDEVEIGLGSQGVSGRALANGNDLPPGTEVRVMVRPQNLTVARKGGGAAD
GLQGRVSEVMVTGSLTKVYMEPLDGKLPPLVAAFPTRNDDDAVRIDDVLTLSWSGRDAVV
IADTLADAARAAGTA