Protein Info for MPMX19_03468 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 63 to 92 (30 residues), see Phobius details amino acids 111 to 151 (41 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF01148: CTP_transf_1" amino acids 58 to 322 (265 residues), 206.4 bits, see alignment E=3.9e-65

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 92% identity to azl:AZL_d04420)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MPMX19_03468 hypothetical protein (Azospirillum sp. SherDot2)
MSSAINSVMTVFTTTEPLFLWLSGAALGLLVVATLIGAVLAYRVKTPAGRDTVRNLNARI
RSWWVMVALFAAAMLLGSGVTLVLFALLSYLALREFITLTPTRRGDHAGLFLSFFVVVPL
QYWLVGIGWYGLFSIFIPVYVFMALPSLSVLGADTTDFLTRTAKAQWGLMLAVYCTSHAP
ALLWLDIPGYNLPPALLLLYLMTVAQLSDVFQYVFGKLWGKTRLSPGISPSKTVEGLVGG
GLTAVAIGTGLHVITPFSPLQAAGMSLIIVIAGFFGGFVLSAMKRDLGVKDWGTMIEGHG
GVLDRLDSVVFSAPLFFHLTRYWFT