Protein Info for MPMX19_03412 in Azospirillum sp. SherDot2

Annotation: putative cystine transporter YijE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 25 to 41 (17 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00892: EamA" amino acids 28 to 158 (131 residues), 73.2 bits, see alignment E=1.3e-24 amino acids 173 to 307 (135 residues), 62.6 bits, see alignment E=2.5e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MPMX19_03412 putative cystine transporter YijE (Azospirillum sp. SherDot2)
MMDETAGGRRNGTARQTAAGTEPSPTIYLQLAGVVLFWGANWPLMKLALLDIGPLAFCAV
RLVGTIVSLALLAPLLRFPLLPHRGERLMIAVVGLLQVGGMMGLSNIGLQFVSPGRASVL
AYTMQMWTLPLGLLLLGERISKRQAAAALLTFAGVVVFFNPALVNWNDINALIGNGFLIG
CAISWALGATLYRRRLWRTPFWTQIFWQVAASAAVMAPLALFAETAHPINWSGSLLAVIA
YNCLIATGLCYWWWSKALSVMPASQAGQIVCLVPVTALLLSAVFDSEPLSLGVLLSVALI
GGGIALSARAR