Protein Info for MPMX19_03403 in Azospirillum sp. SherDot2

Annotation: Glutathione transport system permease protein GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 281 to 307 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 75 (75 residues), 48.1 bits, see alignment E=1.2e-16 PF00528: BPD_transp_1" amino acids 113 to 313 (201 residues), 145.9 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 41% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 54% identity to bbr:BB2362)

MetaCyc: 38% identical to nickel ABC transporter membrane subunit NikB (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>MPMX19_03403 Glutathione transport system permease protein GsiC (Azospirillum sp. SherDot2)
MFAYTLTRLVYLALVLAVMSVLIFLVTQAMPGDVASMIAGQFASKEVVDAIAVKLGLDQP
LIVQYGHWAAGILRGDLGRSLVLEQPIGPILMEALARSLVLAVVALFVVAVVGIGLGVLA
AVRRGKLTDQLVSGVSYLGIAVPDFFWAIVLVLVFGSYMKLLPTGGYAPIADGFLPWASH
LVLPVVTLVLMLLARIARLTRSSMIDVLQTNYVKFARAKGMPESVVILRHALKNALLPTI
TVLAIDFGLILGGVVVIETIFSYPGMGRLLLFAIQRHDLPLIQATILIVSAAYCLANLTA
DLLYAFVNPKIRHGMRAS