Protein Info for MPMX19_03402 in Azospirillum sp. SherDot2

Annotation: putative D,D-dipeptide transport system permease protein DdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF12911: OppC_N" amino acids 30 to 67 (38 residues), 27 bits, see alignment 3.3e-10 PF00528: BPD_transp_1" amino acids 108 to 289 (182 residues), 108.6 bits, see alignment E=3.3e-35

Best Hits

Swiss-Prot: 43% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 57% identity to bbr:BB2363)

MetaCyc: 44% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>MPMX19_03402 putative D,D-dipeptide transport system permease protein DdpC (Azospirillum sp. SherDot2)
MTDATPARAPVQPAPRRGLLDRLPSLPVSFLVGIVLLAPLVVAAVAGSWIAPYPYDEMNI
MSRLQPPGTEFWFGTDEFGRDVFSRTLVGTGSSLVMGVAATALSLLAGVPLGLIAGYKGG
RTGEAIMRAMDVLMSFPPILLGILVLAVTPPAQWKAIVAIGIVYVPQVVRLTRAITLELM
QEEFITAARLRGESAAYILFHEILPNIWPPLVVEASLRVVFAILLGASLSFIGMGAQPPS
SDWGLMISEARPFVEQAPWIALCPGFALATAVIGINLLGDGLRALLDPRNTGAH