Protein Info for MPMX19_03311 in Azospirillum sp. SherDot2

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 299 to 327 (29 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 76 to 353 (278 residues), 162 bits, see alignment E=8.5e-52

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 92% identity to azl:AZL_a06340)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>MPMX19_03311 Ribose import permease protein RbsC (Azospirillum sp. SherDot2)
MSNPTTKTLDAAPSATPRQPVSDGPQTMSGPISGRVMNDRRKDLIQKFAALAGLLVLVAV
FSATSDAFLSVGNGMTIALQVTSIAYLGIAATCVIITGGIDLSVGSVLALSGVAAALAVK
AGAPVPLGMGLGILVGAFCGLLNGLCVTRLKLPPFIATLGMMMVARGVALQITGARAVSG
LGDSFGELGNGAMFRIVRIGEDGFPDVVFPGIPYPVVLMVVIAIAVAIMLSRTTLGRHIY
AVGSNAEAARLSGVNVVGVTLFTYVLSGTLAGLTGCVLMSRLVTAQPNEGVMYELDAIAS
AVIGGTSLIGGVGTISGTAIGAFVIGILRNGLNMNGVSAFTQQIIIGLVILLTVWIDQIR
NRR