Protein Info for MPMX19_03280 in Azospirillum sp. SherDot2

Annotation: Inner membrane ABC transporter permease protein YdcV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 261 (179 residues), 59.1 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 71% identity to agr:AGROH133_14237)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>MPMX19_03280 Inner membrane ABC transporter permease protein YdcV (Azospirillum sp. SherDot2)
MSRPMPSPTRVLHYAFCCAMMVFLVGPILAVIPISFSSAGFLSYPIPGLSLQWYDKVLAA
SGPWLPALRNSLIVGTGAMALATVLGTLAALGLARNDLPVRSFLLGLLIAPMVVPVVISG
VAMYFLFARIGLTASYAGLILAHAVLGAPFVVITVTATLRNFDTTLVRAAYSLGASPVRA
FLTVTLPLILPGVLSGGLFAFIFSFDEVVVALFIGGPEQRTLPRQMFDGIRDTIDPSILA
MSTLLVGVTIVFMGLLARLGRGTGSKPGSNA