Protein Info for MPMX19_03269 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 37 to 326 (290 residues), 85.8 bits, see alignment E=5.7e-28 PF13416: SBP_bac_8" amino acids 46 to 338 (293 residues), 72 bits, see alignment E=7.5e-24

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 71% identity to bra:BRADO4396)

Predicted SEED Role

"ABC transporter, substrate binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>MPMX19_03269 hypothetical protein (Azospirillum sp. SherDot2)
MKKAAWMAGCALALSILGAAGAQAETTLRIMWYSDGNEGEVMNDLLRRFEEKNKDVKVVL
DQVPFKAINETLPVQLASGQGPDLARITDMGGLAPYLLDVRAHVKDAAYWEQNYGPFLQW
MRVPGNTTAIPGYMTQLTVTGPFVNKTLFEQAGVAMPGANATWEDWAKAAKAVADKVQAP
FPVAFDRSGHRFFGLAVSQGAQMAETGGELKPVDDGFKRAAKLVVDWHKSGVMSKELWGA
VSGTAYRGANEEFKNAQVVFYESGSWQTAQFDKTIGDAFDWIAVPTPCGPANCSGMPGGA
ALVALKTSSHPAEVGRLLDYLASEEVAGEFYARTLFVPGHIGLAKKGIAYKSASPQAAAA
LKVFGDAVGKLDPVAYRIQGDPSSRIVFNAAISRLGQVVVGETSLDDAYQRISADVAQQI
AERKKKQ