Protein Info for MPMX19_03258 in Azospirillum sp. SherDot2

Annotation: Glycine betaine/choline transport system permease protein OusW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 143 to 169 (27 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 274 (162 residues), 81.4 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 70% identity to ara:Arad_8148)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>MPMX19_03258 Glycine betaine/choline transport system permease protein OusW (Azospirillum sp. SherDot2)
MEGLGFAGAFAGAFDDIVDSGLGWLGDNAGALFDFVRAVLEGFYGAVFWVLSIPPFYVIA
VAFALIGWRVVGLRFGVLAGAALVGCALMGLWPETMSTLALVISSTILALLVAIPAGVLT
GFAPKVDRSLEPVLDLVQTLPPYIYLLPGIALLGYGPATALAATFVVAVPPAFRLTALGI
RLTPNEFLELGQSTGMTNWQMFAKIRLPFAVPSIMAGINQSLMMAFGMVVIAGIVGSGGL
GETIYKAVRTLDIAKSIDGAIAIVILTIVLDRLTQGAARLGSQPGYGGGK