Protein Info for MPMX19_03225 in Azospirillum sp. SherDot2

Annotation: Organic hydroperoxide resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF22381: Staph_reg_Sar_Rot" amino acids 59 to 139 (81 residues), 68 bits, see alignment E=1.8e-22 PF12802: MarR_2" amino acids 68 to 127 (60 residues), 36.4 bits, see alignment E=1.5e-12 PF01047: MarR" amino acids 71 to 128 (58 residues), 54.9 bits, see alignment E=1.9e-18 PF13412: HTH_24" amino acids 80 to 117 (38 residues), 22 bits, see alignment 3e-08 PF13463: HTH_27" amino acids 83 to 136 (54 residues), 31.4 bits, see alignment E=5.7e-11 PF01325: Fe_dep_repress" amino acids 87 to 117 (31 residues), 26.5 bits, see alignment 1.9e-09

Best Hits

KEGG orthology group: None (inferred from 60% identity to bpy:Bphyt_4137)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>MPMX19_03225 Organic hydroperoxide resistance transcriptional regulator (Azospirillum sp. SherDot2)
MVIGTTELSGDDMSRKSASPTTPPTSDTPAAALAGKSQTARLADFMCFTIYSANLAYSRV
YKPVLEQLGVTYPQYITIIALWEEDRQTVKSLSEKLFLEPSTMTPMLQRLEAMGYVTRTR
DDEDERSVRVTLTEAGRQLREKGLGFGELTVKASGLPPDEFRALQRAVARLRDNLREASK