Protein Info for MPMX19_03122 in Azospirillum sp. SherDot2

Annotation: [Citrate [pro-3S]-lyase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00124: [citrate (pro-3S)-lyase] ligase" amino acids 20 to 341 (322 residues), 383.2 bits, see alignment E=9.8e-119 PF00583: Acetyltransf_1" amino acids 34 to 111 (78 residues), 22.3 bits, see alignment E=1.3e-08 PF08218: Citrate_ly_lig" amino acids 152 to 338 (187 residues), 230 bits, see alignment E=1.7e-72 TIGR00125: cytidyltransferase-like domain" amino acids 155 to 208 (54 residues), 30 bits, see alignment 4.5e-11

Best Hits

Swiss-Prot: 50% identical to CITC_KLEPN: [Citrate [pro-3S]-lyase] ligase (citC) from Klebsiella pneumoniae

KEGG orthology group: K01910, [citrate (pro-3S)-lyase] ligase [EC: 6.2.1.22] (inferred from 96% identity to azl:AZL_a08510)

MetaCyc: 50% identical to [citrate [pro-3S]-lyase] ligase (Klebsiella pneumoniae)
[Citrate (pro-3S)-lyase] ligase. [EC: 6.2.1.22]

Predicted SEED Role

"[Citrate [pro-3S]-lyase] ligase (EC 6.2.1.22)" (EC 6.2.1.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX19_03122 [Citrate [pro-3S]-lyase] ligase (Azospirillum sp. SherDot2)
MTDELDFYAVDPATSARERRDIRALLGRCGLDYEEHIQVFVVCRDAGRLVACAGLESNIV
KCCAIDPDLRGGSLSLTLLSEVVHLAYERGHSHLFLYTRPENVSFFQGCGFYALAEVPGY
VTLMENTPVGIRAYCDRLRAQRPPGLRPDARIGGVVINANPFTLGHQYLVRLAAAQCDWL
HLFVVSEDVSFVSYRDRYALVEQGVRGIERLTLHHGSQYMVSRATFPDYFFKEKGVVGDC
CTAIDLLLFRNHIAPALGITHRFVGTEPFCETTRKYNADMKFWLQGAGSTAPAVTVIEEA
RTRSGGTPISASEVRRLLRSRDLDRIRALVPAPTFELLREKYLSKILPFAPDPLGHGGEP
DAPARRAVAAGI