Protein Info for MPMX19_03110 in Azospirillum sp. SherDot2

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 14 to 247 (234 residues), 123 bits, see alignment E=1.6e-39 PF02801: Ketoacyl-synt_C" amino acids 256 to 368 (113 residues), 112.9 bits, see alignment E=9.2e-37

Best Hits

KEGG orthology group: K14660, nodulation protein E [EC: 2.3.1.-] (inferred from 46% identity to rru:Rru_A0045)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.179

Use Curated BLAST to search for 2.3.1.- or 2.3.1.179

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>MPMX19_03110 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Azospirillum sp. SherDot2)
MTGGRYRRPDGSHRVVVTGVGAVTGFGVGLPAFWQGVTEARTAIQPTCRTFEAMEVVRPA
ATVVGYLPLDHFSEAQLLTCEPFVQYALLAAREAIAAAGLTSADLTDAAIVLGCGGGGEL
SRQETAIHLFANRRPRAHPTTVPRTNHQACCGMIAIEHGILGPSFVVATGCASGSHAISQ
AAMMVRHGYADRALTGGTEANVIYAVMRCFDAARTIASDTCRPFSTGRSGLALGEGSGIL
VIETMESADRRGAPVLAEIAGFGMSSDATDTVQPTIRGPVRAVMQALADAGLNTDEIGYL
NAHGTGTPLNDRVETAVAHAVFGPHAARLMMSSTKSQIGHTFGAAGALELIATILGLARG
VAPPTVNYQGADPDCDIDCVPNEARAHRFGAAVSQSFAFGGVNAAIAVRAV