Protein Info for MPMX19_03089 in Azospirillum sp. SherDot2

Annotation: Macrolide export protein MacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 386 (345 residues), 152.9 bits, see alignment E=5.2e-49 PF16576: HlyD_D23" amino acids 50 to 268 (219 residues), 64.1 bits, see alignment E=2.3e-21 PF13533: Biotin_lipoyl_2" amino acids 68 to 107 (40 residues), 38 bits, see alignment 2.2e-13 PF13437: HlyD_3" amino acids 190 to 271 (82 residues), 32.7 bits, see alignment E=2.1e-11

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 50% identity to vpe:Varpa_4318)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX19_03089 Macrolide export protein MacA (Azospirillum sp. SherDot2)
MTRSPPPARRRYRAVLAVGVVVAGFATAALLRPGDPAASAELAVIGRGTVEDTVTALGKI
QPRAYVDVGAQVSGQLMRLHVKVGQMVREGDLLAEIDPALQQAKVEAGRAERARLTALLD
ELRARADFAQAQLARQTALRRVEAGRGESYDQARMEARTAAAQVDATLAQIRQTDSTLQA
DEAQLGYTRIYAPMSGTLIAVDARQGQTINSTYEAPVLMRIADLSAMTVWTQVSEADITR
LTDGMPLYFTTLGHPGRRWTARLQQILPAPPKPVTSGSANGAASSGGGTGASTVVLYTAL
FEVANERGDLRPEMTAQVFFVAAEAKDALTVPVAALTATDEESGRHSVAMIGEGGAVVTR
EVRIGVRDRFNAQILQGLAEGERIVVGWRTDDGRPPRIGFRL