Protein Info for MPMX19_03080 in Azospirillum sp. SherDot2

Annotation: Ferrichrome receptor FcuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details PF07715: Plug" amino acids 178 to 273 (96 residues), 65.4 bits, see alignment E=6.4e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 180 to 825 (646 residues), 352.2 bits, see alignment E=3.3e-109 PF00593: TonB_dep_Rec_b-barrel" amino acids 362 to 795 (434 residues), 137.8 bits, see alignment E=1e-43

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 54% identity to pla:Plav_2064)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (825 amino acids)

>MPMX19_03080 Ferrichrome receptor FcuA (Azospirillum sp. SherDot2)
MALAKFGVKGECRGSVRTGLFGRLFLGRLLATTVLIAPGLLLPGIPAAMAQTSPAAVSFA
IAPQSVDGALAAFSAATRIQVLTPGAVTQGVASPGVSGAMTAREGLNRLLSGTGLVARFL
NTETVTVERVAAGGAVQLDPVQIEGNRTATGPGALPPAFAGGQVARGGRIGALGNQDAMD
VPFSVTGYTAETIRNQQAETIADVLANDPAVRSSLGYGNFAESFVIRGFQLAGEDLSVDG
LYGTAPRQIVATNMFERVEVLKGANAFLNGAAPSGSGIGGGVNLVPKRAEDEPLTRLTAS
YAMDSRLGLSADVGRRFGDANQFGVRVNAAVRGGDTAVDDEKRTLKLGSLALDYRGERAR
VTLDVGTQTQRVEQGRPVVYFGSFVPTVPSASQNYAQPWTYSQMRDTFGQVRAEYDILPN
LTAYGAFGLRSMREDGDYGSPTVTRPDGTGTVRRLTVPREDFTSTGQAGVRADLHTGPVR
HQLNAGASALRTTNNNGFEFGTTTAINLYRMVGMPRSATTSASGMTGDLPKVSESVLRSL
YASDTLSILDDRVMLTAGLRQQNIQVRGYNRANGARTSDYDQSALTPVVGLVVKPLKELS
LYANRIEGLAQGPTAPSTAANAGEIFEPYRSVQYEVGGKLDFGSFGGSLSLFQTTQPSGV
TDAFTRLYSVSGEQRNRGIELMLYGEPVQGLRLLGGATVIDPELTDTGNAATEGKDAVGV
PRHQFNANVEWDLPFLPASFPTVTLTGRVIHTGSQYLNTANTLKIPSWTRFDVGARMIAD
VQNRPVTIRAAVENVTDKAYWASAYGGYLSQGAPLTAKLSVSVDF