Protein Info for MPMX19_03072 in Azospirillum sp. SherDot2
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
Predicted SEED Role
"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)
MetaCyc Pathways
- superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
- glycine betaine degradation III (6/7 steps found)
- glycine degradation (3/3 steps found)
- folate transformations III (E. coli) (7/9 steps found)
- folate polyglutamylation (4/5 steps found)
- glycine biosynthesis I (1/1 steps found)
- glycine betaine degradation I (6/8 steps found)
- dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
- purine nucleobases degradation II (anaerobic) (17/24 steps found)
- photorespiration I (6/9 steps found)
- photorespiration III (6/9 steps found)
- folate transformations II (plants) (7/11 steps found)
- photorespiration II (6/10 steps found)
- folate transformations I (8/13 steps found)
- glycine betaine degradation II (mammalian) (1/4 steps found)
- formaldehyde assimilation I (serine pathway) (7/13 steps found)
KEGG Metabolic Maps
- Cyanoamino acid metabolism
- Glycine, serine and threonine metabolism
- Methane metabolism
- One carbon pool by folate
Isozymes
Compare fitness of predicted isozymes for: 2.1.2.1
Use Curated BLAST to search for 2.1.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (35 amino acids)
>MPMX19_03072 hypothetical protein (Azospirillum sp. SherDot2) MLDTLKAVRSGTLNACGPETNGRVRQLVARFPLPY