Protein Info for MPMX19_03038 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details PF05940: NnrS" amino acids 11 to 357 (347 residues), 197.8 bits, see alignment E=1.9e-62

Best Hits

KEGG orthology group: None (inferred from 40% identity to mag:amb3505)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>MPMX19_03038 hypothetical protein (Azospirillum sp. SherDot2)
MPTPITSTVTSAHRPMYPAAALYAALAVPLWLAQVGGLLPTGWSPAVHAHEMTLGYALAV
VGGFLMTRLSRPMVAVALLSWLAGRLALLLGLPPLLALPLCFAYPLLLFVVAGLPFLRTS
RSGHNAVFGPLIGAFLGAEALFWAGALGLVPASGQPVALLLIATLLLTMGGRVIPAATAG
ALRRQGVTLAHRVQPRLEAMGIAGAALCLLSAATGLLPLAGGAGAAMAGASALLRLARWK
PHLLLRRPEIASLHLGYLCLGAGWLLTAGTPLLDLPPAAGWHMLGVGALGILASAMMIRT
TLQREAEPERFPPAASVAVGLMAAAAVLRLTAVGWPSMTLLTAAAVFWTLGQLLTAGVLL
TRPRRSRRRQDALQEA