Protein Info for MPMX19_03036 in Azospirillum sp. SherDot2

Annotation: Glutathionyl-hydroquinone reductase YqjG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 64 to 156 (93 residues), 33.5 bits, E=1e-11
• PF00043: GST_C
  • amino acids 198 to 278 (81 residues), 36.6 bits, E=9e-13
• PF13410: GST_C_2
  • amino acids 202 to 274 (73 residues), 65.2 bits, E=9.4e-22

Best Hits

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 89% identity to azl:AZL_b00130)

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (333 amino acids)

>MPMX19_03036 Glutathionyl-hydroquinone reductase YqjG (Azospirillum sp. SherDot2)
MPQLVNGVWEKGDIAASEIKGGAFHREPTRFRDWITPDGAPDAEGNATVPAVAGRYHLYV
SYLCPWASRTLIFRALKGLEGVIGMSAAEPVLGEDGWVYGEEQDGGPRVGRFRHHYSLYT
ASDPTYTGKVSVPVLWDRQEGRIVNNESANIIRILNGAFDGLTGNRLDFYPEPLRPEIDR
WNELVYTTVNNGVYRCGFAKSQASYDEAFDALFATLDRLEERLSASRYLAGEHLTEADWR
LFVTLVRFDAAYHGAFKCNLRRIEDYPNLSAYLRELYQWPGIRDTVKIDHIKAGYYTNPA
INPTLIVPKGPALDFDRPHDRDRLPGKGIWQRA