Protein Info for MPMX19_03006 in Azospirillum sp. SherDot2

Annotation: Ribose import permease protein RbsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 263 to 295 (33 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 316 (266 residues), 131.4 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 37% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 43% identity to ype:YPO2499)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>MPMX19_03006 Ribose import permease protein RbsC (Azospirillum sp. SherDot2)
MTDTATGSLPSHDRLFGLRKEHVQRYSTLVVLVAMFLVFSLGVDRFLTGQNLLNIAQQIS
MLTIVGAGLTFGFAAREMDLSVGYTVGLAGVLVPLLLVKGVPLPLALLAGLGAGLAVGAV
NALLVTLVGIPSLIATLAVGSILYGINFLMTGGRAIYGGLDEAYLWLGQGRVAGIPVLAF
FMLAAVLVAWFVMERTIFGRYIYAVGGNQKAAELSGIRVRKYRAAALVVCSLFAVMAGTL
LAARLGSGQPNAGERYLLDGLATVFIGMTMFRPGTATVPGTFFGALFIGVINNGLNLMGM
DTYIQAIVKGVIILAAVAVVSRSTKLNLL