Protein Info for MPMX19_03002 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02627: CMD
  • amino acids 23 to 104 (82 residues), 66.8 bits, E=7e-23
• TIGR00778: alkylhydroperoxidase AhpD family core domain
  • amino acids 41 to 88 (48 residues), 48.1 bits, E=3.2e-17

Best Hits

Swiss-Prot: 46% identical to Y4147_CUPNH: Uncharacterized protein H16_B0147 (H16_B0147) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 66% identity to smd:Smed_3036)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Protein Sequence (111 amino acids)

>MPMX19_03002 hypothetical protein (Azospirillum sp. SherDot2)
MDDAKTDLAAAKARLGAFAKASPALMKGFAEVSRTASAAGSFTPAQKELMAVAISVATRC
EDCILYHVDGARRHGAAEAELVEALEVAVEMGGGPAVMYAGKALAAFRSLG